DPCstruct | MC10454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 456 ± 113 aa |
| Standard deviation of domain lengths | 112.80 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1VW30 | 5-290 | VFRALAAFGIGAETTNAADGLMVYGADDPELTATFDKLLRADSIFGATAGYLASLDSYLEGEESARLDAGAAKFLARLQTQRRRFFF… |
| A0A517WJM7 | 107-623 | AGELTTVHIVRDLTGLPETGKTGGFMTKTELLESFSYTIFDKSAGSVFLIAANDGQLVDTWARLNESKKHIDDTRRLLESLLFNDHR… |
| A0A1D7QWZ9 | 460-947 | None |
| A1ZY61 | 73-464 | None |
| A0A6N2Z7G5 | 3-329 | None |
| A0A553KJ89 | 2-261 | None |
| A0A3R9KXZ1 | 33-418 | None |
| A0A542HDS1 | 173-837 | None |
| A0A2T1CH70 | 716-1246 | None |
| A0A4U1H693 | 63-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.