DPCstruct | MC10453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848GW76 | 3-91 | RPRIYVDFNEMIAEDLVLLSQEDTKRDSAGNLVQLFEGKTIDIFMDDTNERGEKDNLIASGTVEANTTGLFPVCKWNCRIDANGIRH… |
| A0A517WGX6 | 1-87 | MKPRIYADFNKLDKDRNAILVCYGTNKDLDEQKLKLVKGLEVILYMPDGADEEGNADGLEVDAVIEYDSINNFWIGVFEWEELDYRS |
| A0A7U9RQK4 | 8-115 | None |
| A0A7W6KWN8 | 3-88 | None |
| A0A535Z800 | 3-77 | None |
| R9MIY1 | 3-95 | None |
| A0A5C0DRP9 | 22-101 | None |
| A0A2D2DPU4 | 190-283 | None |
| A0A858X4R1 | 9-93 | None |
| A0A2T6G150 | 12-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.