DPCstruct | MC10451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 482 ± 56 aa |
| Standard deviation of domain lengths | 56.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4BQV2 | 59-660 | LWLPFAAKFNDGLELVAPVDIEWVWLCHLLSPVTYAKDCLAICGKIIDHKLRSKQERADGLEETQHLWDQEYPNDKFVISLDAVIDI… |
| A0A835QXL2 | 2-498 | ILPPPDVDWVWLCHCLDPESYRKYCAARFGLLIDRPVIIDKENEEYASGRCREIWEIRHPSEPFDLEIDDYDSAETVVSGIDIRSEI… |
| A0A813AIV2 | 8-470 | None |
| A0A6A6L2V4 | 14-436 | None |
| A0A7I4C6M9 | 4-468 | None |
| D8R364 | 17-391 | None |
| V4B8Q5 | 76-517 | None |
| A0A210PYN9 | 117-584 | None |
| R7Q6F8 | 73-582 | None |
| A0A834LGV6 | 25-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.