DPCstruct | MC10450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 350 ± 31 aa |
| Standard deviation of domain lengths | 30.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 64.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835QMK2 | 1-370 | MEALVENTFVNNKGNWLGIQRQLSKLERQQTNLMKMLQDFMGGSHDSLITLEQRVCGLERVVEEIAQDLSLSSGRRGGAMVGFVESP… |
| A0A7S1AD65 | 143-454 | EDKIKVTEERLHDQAILLQQAEQQLQKLDSKVSRQDQKHEHHEEVFRRSETRMDRHDAQISEHRAFLDLLSAEVEEHVFTPPSASER… |
| A0A2N9I347 | 278-667 | None |
| A0A1D6EX72 | 56-378 | None |
| A0A427A8M1 | 153-542 | None |
| A0A2K1IJZ8 | 276-645 | None |
| A0A7C9DH35 | 1-314 | None |
| A0A0V0IV87 | 283-671 | None |
| A0A072UCW5 | 485-811 | None |
| A0A0K9PJK2 | 552-876 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.