DPCstruct | MC10449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 504 ± 67 aa |
| Standard deviation of domain lengths | 66.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8AC49 | 192-684 | IDIQTSKLLDWLLDRRHCNLKWQSAVKEIREKINAAIQDMPENEEIKQLLSGSYIHYFHCLRIVEILKGTEASSKNIFGRYSSQRMK… |
| A0A835QMD6 | 66-574 | SIGYLEANKIYNILLSTSTGSRNIFGRLSGYAGEWENIVRDYEKEHVFLGEAAQMIVQNVNYEIPYQKKQMQKLQQQLAELERKEAD… |
| A0A453RF34 | 4-482 | None |
| A0A1X1BH74 | 291-752 | None |
| A0A7S3T2J0 | 23-457 | None |
| K1PYW7 | 2-528 | None |
| A0A2G5ECZ7 | 2-451 | None |
| A0A6S7NP75 | 598-1129 | None |
| A0A815U3U5 | 61-535 | None |
| A0D8Q5 | 2-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.