DPCstruct | MC10447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 211 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3J0P2 | 106-301 | SNPSIMEPKQPHPLHQIAETPTHRLLLKQWLKEEELILNRISLKETQIDSVRKEITQLYIFFFLFHSISLLILFNSSTKEPLAAGCR… |
| A0A835QER4 | 1-190 | MQHHPLTEISASPGHLLLLKLWQREEGLIASRIGSKEAQLDAVKREAFQLCSLLFFFHGLFLTLLFVSSVGQSEDRRACRGWWVPGC… |
| A0A7N0RCJ2 | 3-213 | None |
| A0A2I0A3Q1 | 2-207 | None |
| A0A426ZAF0 | 103-331 | None |
| A0A4S4D7Z5 | 2-216 | None |
| A0A438HYT2 | 1-201 | None |
| A0A0E0LWF2 | 252-471 | None |
| A0A4S8KHW5 | 2-197 | None |
| V7BQ38 | 66-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.