DPCstruct | MC10446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 12.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151UHH8 | 1-136 | MASTVSLDVPDGPVMSLISKRLYALRKKLNRINAMEDSVSQGKPLNKEQEEVLRSKPSVLAFIDELEKLDQPLASALAEELEASVAY… |
| A0A835Q602 | 1-126 | MATSPPGFEPATADGPVLSLMSKRLRALRKKYNRILQMEASLAQGKILNKEQEEVLRSKPGVVALIDEYEKLKSPLAAAVQEEVART… |
| A0A5A7QQA5 | 1-148 | None |
| A0A6A6LHT4 | 4-151 | None |
| A0A0A9D3T6 | 1-124 | None |
| A0A4S4DG02 | 1-137 | None |
| A0A200Q1D0 | 26-141 | None |
| S8DLL7 | 1-127 | None |
| A0A6A2Z780 | 1-154 | None |
| A0A453H4C4 | 95-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.