DPCstruct | MC10442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 110 ± 13 aa |
| Standard deviation of domain lengths | 12.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11290 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831TFX0 | 14-119 | LSREEAAGPDVPEEQPAVEFRVGRLSMGYEERSDLFVLMAHADDADPDGPPTFRCEASRRQLRALARQIAAICAAGRPRCPRCGAVI… |
| A0A7K2D6I3 | 25-128 | ELPDAEEADPPDDLDMREPVVEAWTIGALGIAYDQEEGLVILVAEELVEDPDDTGASARFTLTRPQVRALVTRARAVVAAGRPPCPF… |
| A0A6J6GGY0 | 1-93 | None |
| A0A1J5Q5V8 | 9-129 | None |
| A0A1J5Q3L2 | 299-393 | None |
| A0A5Q2RKH1 | 82-213 | None |
| X8FBH9 | 1-98 | None |
| A0A6B1GE87 | 10-128 | None |
| A0A7K1ARM6 | 1-107 | None |
| A0A6N9DIY4 | 116-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.