DPCstruct | MC10441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 256 ± 35 aa |
| Standard deviation of domain lengths | 35.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A451F5T1 | 21-277 | REVRRTKKLTGERSIDEWLECLRFIAARDKGGDKLRKRVAIAMALWIVGFILSLVVEFPPAAAGFAVIFIINLIIFFALQSKDVPNR… |
| A0A5C7ATF6 | 5-225 | GVDGEDIFPILFFYPFYYIFLFLILNNYKKYKFVPVDAFQDLAKFIIAIKGDVHKNLINLRIDYSPIEHENNLLDPTKIGLVTRKGT… |
| A0A3B8IYL7 | 5-283 | None |
| A0A1H6C8G3 | 33-225 | None |
| A0A6L9IPK0 | 56-355 | None |
| H8MWL6 | 10-302 | None |
| A0A1L6LXF0 | 16-298 | None |
| A0A346XXI7 | 14-230 | None |
| A0A2M7G5K9 | 1-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.