DPCstruct | MC10440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 238 ± 38 aa |
| Standard deviation of domain lengths | 37.81 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z2HY23 | 234-454 | RTETIEFGSRDAARRARAELDDGALVTDRYDGRHRTIEIDVDEVDDRSLDRVVGMAADSRAHEAEQHGQLELTESERERIDFSETNV… |
| A0A1I1EXZ4 | 85-296 | ESVEFGDRESANAVRDEIPDEHLAESDDQRTKTIELSPEATRATRTRVTGEAADSRAYLADQHGQAELTDAEKRRLDFTRTNVMHAR… |
| A0A8A2UBF0 | 23-335 | None |
| C7P420 | 1-277 | None |
| A0A4P8WJE6 | 3-215 | None |
| A0A7D4YC57 | 3-247 | None |
| A0A482T480 | 1-268 | None |
| A0A6A9T3Y2 | 1-272 | None |
| A0A1M5M6V8 | 1-174 | None |
| A0A5J5LAS0 | 1-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.