DPCstruct | MC1044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 236 ± 15 aa |
| Standard deviation of domain lengths | 15.27 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 28.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5XLU1 | 207-441 | LAGLLEMTGTATGKEKTAVQLMRPKAIREAARLITFQTAMSWRYGQLVAETERYSAVMDTAFNFAPLMLTQGEALIMPPLLTRAGAS… |
| A0A3M1UL94 | 52-303 | KEEAFKGEIPPILKKILALETDKSEIGKKLKDKMNLRVKALKKRAIMLGTQAGFYVRSHEIMDEVNRLSPALDRVFNFNILMLSHGH… |
| A0A179SN08 | 103-338 | None |
| A0A1D8K957 | 2-243 | None |
| A0A6N0LJH6 | 30-259 | None |
| A0A0W0Z6N8 | 8-243 | None |
| A0A522D539 | 139-385 | None |
| A0A2G4E0D7 | 3-207 | None |
| A0A240UJK5 | 18-279 | None |
| A0A2E8JQE8 | 6-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.