DPCstruct | MC10439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 109 ± 15 aa |
| Standard deviation of domain lengths | 15.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F1SC50 | 48-155 | LIGCAGMDYAMKNYSGVKVETWISPTTKKTFRIFDKPTENRMMITLGFGDASAQGIGQGLTLGIADTRTPEGVYQDAAIEWLALRGR… |
| A0A7G2U2H0 | 2-117 | KNKAIASSLLLIAACGGVNEAITKYGSTKPVTYEIGEEKWRIFDQPENNRLMITPTVGASAGQGAVTGITYGLARNPYSQRETFEPP… |
| A0A2A6M7S9 | 73-172 | None |
| A0A2A6NZG2 | 4-96 | None |
| A0A1I5EQT4 | 6-99 | None |
| A0A3D2PKG7 | 3-96 | None |
| A0A0N0V4B9 | 28-114 | None |
| A0A7C4Y019 | 9-140 | None |
| A0A519HL26 | 1-120 | None |
| A0A1C1YYA6 | 57-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.