DPCstruct | MC10436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A140K6P6 | 3-63 | KSLINTCNECGSLYYQQTSKMSSLCSECSHVLYGYELCIHEFKNGRCEKCYWDGSVSEYIK |
| A0A653HSY2 | 3-62 | KTEQSHLLCDECGSEFFNNVSPMKNRCPNCSHLLYGLNNCEHHFKEGRCQQCGCHGQTSK |
| A0A345GUD8 | 2-68 | None |
| A0A1I1LA19 | 1-51 | None |
| A0A7L4ZK63 | 2-67 | None |
| S5ZXD5 | 10-77 | None |
| A0A1H3GCW8 | 2-63 | None |
| A0A2G3MFG3 | 2-61 | None |
| A0A1P8RT45 | 1-60 | None |
| A0A5B1CCN3 | 87-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.