DPCstruct | MC10433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 167 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2QZA7 | 12-195 | LARIQADVARGADVTGPLGALEDEVARTERDLIVATARSRALSRDRERAVALRSALADRAPVIQQVADRCRREVADPPRLAVPDVTR… |
| A0A840NPX1 | 173-333 | FRARLDLLARAVDELAQRENALHRHRAHVAGRIAGAPAVPDRAIALRLVVTGLRTDDPGMAPEARARRLARAEADVAETSRLLRERR… |
| A0A2W6CPI8 | 2-140 | None |
| A0A5Q0H5Z8 | 375-528 | None |
| A0A344L576 | 296-451 | None |
| A0A7X9Q1X7 | 150-345 | None |
| A0A370CVQ7 | 128-298 | None |
| A0A1C4WLF6 | 175-338 | None |
| A0A1C4K3V0 | 1-186 | None |
| A0A2S6GMI6 | 212-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.