DPCstruct | MC10431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 109 ± 22 aa |
| Standard deviation of domain lengths | 22.16 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 28.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R8WES1 | 3-89 | NVYGADVAQLRQLAASLRSAGRRLEGQQQSLAGQVTTVRWPGPDAERFRRAWQASHSSSLSAAASFLNSAAEAVLRHAQEQEGGQFG |
| A0A7X6P3G1 | 1-85 | MIEGAQVEELERLARRLKVIADTLRTAESQLSGDVRRVDWRGSRSTAFKTAWHSRYAPQLRQHATLLRASSEALSAQAAAQRTAS |
| A0A7K1B191 | 1-86 | None |
| A0A653MC00 | 3-114 | None |
| A0A839QN74 | 1-113 | None |
| A0A4Q2SDD2 | 30-116 | None |
| A0A3A5H3M6 | 1-89 | None |
| A0A1H4M725 | 1-128 | None |
| A0A0K2R947 | 1-99 | None |
| A0A124ES49 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.