DPCstruct | MC10429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 12.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2MZ79 | 166-260 | TGIADIIKQINSTINPIFNLTTGSIDWVSTIIMLVGVLSTLLYFYFAIEFKGPVLNVVKIGIIFLMIGFGTAFGFTVMARASLAIQI… |
| A0A3D0J870 | 1-105 | MALAPTIQADVLKQMQSAIADATNLKLGGWSLVWGLITFIGVLTTLSYFFFSREQKGALKVSANIGIWFIMIGFGASFGNTVMARVS… |
| A0A836QIH0 | 61-166 | None |
| A0A7X1ZRK4 | 125-235 | None |
| A0A3L7TG86 | 305-425 | None |
| A0A3B8V569 | 1-136 | None |
| A0A3R7RMS5 | 339-473 | None |
| A0A381US38 | 161-277 | None |
| A0A7S6S3S8 | 219-347 | None |
| A0A2V8TC93 | 149-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.