DPCstruct | MC10425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 125 ± 24 aa |
| Standard deviation of domain lengths | 23.63 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 39.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5TQK0 | 169-308 | ALTISSSEANWDPATGYVRDYKPTDEWLSQQPSKMTSDIQVSECARNTRLAYPHVQLFAYFEVNHAADCYHGCPYGNCHAFTTFPQP… |
| A0A4Q4WBW1 | 1-131 | MFRSTTLITLLALAVSVTATLDPATSNTKGKCPANPGCSPAKTSNAIQAAECSHNTRVSGTQTFAIFKTDHQYDSSHGAPYGTCEAY… |
| D0N9J0 | 15-102 | None |
| E3K8V7 | 2-108 | None |
| A0A2N5V8D8 | 11-156 | None |
| A0A7S5LK49 | 59-193 | None |
| A0A329RHR0 | 1-110 | None |
| A0A2L2TP55 | 2-109 | None |
| F4RA51 | 3-155 | None |
| F4RUZ5 | 28-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.