DPCstruct | MC10422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 5.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6HBL3 | 101-163 | WNASKSSGPNVIGGPTLGGNYYAKPDGTGFSQTCDDLDGDGICDSANGFGTGSDDNTDFLPLT |
| A0A645DSF3 | 167-230 | SANSWNVTKNPGTNIVGGPFLGGNYWASPQGNGFSQINPDTDYDGICNVAYNLGKGNIDYLPLA |
| A0A0F8SI94 | 364-430 | None |
| A0A497REC0 | 821-888 | None |
| A0A1E7G872 | 222-284 | None |
| A0A7C0UKM1 | 286-347 | None |
| N0B921 | 208-271 | None |
| A0A0E3WXL3 | 326-398 | None |
| A0A5E4HG22 | 411-472 | None |
| A0A498H3P3 | 436-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.