DPCstruct | MC10421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 141 ± 4 aa |
| Standard deviation of domain lengths | 3.94 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E7IVG0 | 634-767 | YIDNLALSPRLRDTVERLRIERQLDQLIRELENGDTHSGQPLPEQLHDLPTLRSWPTDRYIEVTDAEGVVSATYPSNASHDAALRVV… |
| A0A3Q9D6Q9 | 312-451 | IHVNSEPTPPLLSDTLARLKIDRELQQLIDNLRSDDPAVYHAVDPQDQLQLLTSYGYWPKSKGLAFFNERGEVTWNFGDPEKPSVRI… |
| A0A3M3NZ68 | 109-247 | None |
| A0A7Y8RTK2 | 277-412 | None |
| A0A6A7YUQ6 | 334-477 | None |
| A0A7U6FJ43 | 469-615 | None |
| A0A3M6BR39 | 1-142 | None |
| A0A1B5F8Z0 | 5-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.