DPCstruct | MC1042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 87 ± 17 aa |
| Standard deviation of domain lengths | 17.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2CTU7 | 40-104 | SCMKEVKAIKKPIPVTAFQAETALDIKTLEGIMHANIGDWIITGIDGEQWPVKKEIFEKTYDIIR |
| A0A4T2B7P4 | 1-70 | MKFRKKPVVIEAMLFAGGAFTTAAENIAITTLEGTMAASIGDYIIKGVAGEFYPCKPEIFEQTYEPALTP |
| W5WCM1 | 125-226 | None |
| A0A7G6E428 | 3-105 | None |
| A0A1Q7LPX3 | 5-69 | None |
| A0A349XYG7 | 1-104 | None |
| A0A0F9UEG2 | 22-86 | None |
| A0A7U0WA34 | 70-177 | None |
| A0A3E0D3A0 | 308-400 | None |
| A0A316REX4 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.