DPCstruct | MC10419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 8.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357LD92 | 64-157 | RLDYICRLLDISVTPEAGLRYQLFHRSAAAIVEAQRFGFGDAAMIVHSFSPTNQWIDDFQAFRRALGLMANPLEPASTRLKVGVNLT… |
| A0A1E4QTF4 | 1-100 | MRLQFLTKKLGLTNLPGTISYQLIHRTASALIEAARFNAAHALMLVHSFSPTQQWFPDFRSFAQLYGIDAKPNQIYQACELEGIALH… |
| A0A2V8BXD7 | 1-117 | None |
| A0A7T9ERH7 | 139-250 | None |
| A0A0F2J2A5 | 341-438 | None |
| A0A660L9D6 | 128-228 | None |
| A0A2A9C045 | 129-227 | None |
| A0A512AR71 | 83-180 | None |
| A0A5E4P1V7 | 1-85 | None |
| A0A5C8UG04 | 80-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.