DPCstruct | MC10417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 195 ± 16 aa |
| Standard deviation of domain lengths | 15.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522CCG4 | 12-197 | TKSTADEVVTYLLDAYQDERGVHAETVIGAAAALTGEHILRACHTDEQLAGNGWITSSPADAFLFEDEQDITIYDLIKAITGLKDDM… |
| A0A1E4QN89 | 2-183 | VAIGACAGFSAQLAVWQALIQRLNRDPGDFLVHVNTKSNESFVYGESINQFLFVCPPDRLSFLSVAAGNLRSDQELPDIRELAAHVM… |
| A0A839LEU3 | 37-245 | None |
| A0A525JVI3 | 17-244 | None |
| A0A327KF07 | 10-177 | None |
| A0A170PQ01 | 130-326 | None |
| A0A438KVH1 | 83-288 | None |
| A0A839JQ76 | 41-238 | None |
| A0A2A4B991 | 16-199 | None |
| A0A430BJN8 | 126-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.