DPCstruct | MC10416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 136 ± 18 aa |
| Standard deviation of domain lengths | 18.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554VUN8 | 2-130 | GYTHYFPGLMATAEVIDDARKIIDNTSVTVCGPKGQGLPILDETEGIRLNGSRAAGEAYETFHLRGTKEPHYPDMWTFCKTEQKPYD… |
| A0A2I1CN75 | 176-313 | VSYTHYYTVDNTSSHEWRAAWPQLVEDAQKIIDYSGVPIGGPDFDEPCPPIIDVQQGIHLNGVGDDGYEPLCLDRHGNAGFSFIKTA… |
| A0A509JFT4 | 1-150 | None |
| A0A421D511 | 215-355 | None |
| A0A6P8AU15 | 556-728 | None |
| B8MNN6 | 38-154 | None |
| A0A1V6TYT0 | 1-113 | None |
| A0A2U1X3H7 | 2-145 | None |
| A0A6M6E5U0 | 1-128 | None |
| A0A395H496 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.