DPCstruct | MC10413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 64.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09320 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3GM33 | 382-493 | RRYAQEDDITPEEIFNMFFGGGFRPRGRRPQQQQPQQGQRQQQEQRGGMANLAQFLPLLLIFLMSLLSIPSTPEMPFSLNPTQQFNV… |
| E9GD69 | 203-304 | EELFNMFFGGSFGGPNVYVRRGRQWERQRAENANQQGSVGSGLLLQLMPILILVFLSVMSNFLVSDPIYAFQKSNKYSLEKHTTALK… |
| A0A662XD70 | 183-304 | None |
| R7W982 | 251-384 | None |
| A0A0R3T439 | 187-298 | None |
| A0A7J6QVS7 | 23-147 | None |
| A0A4D9BKW2 | 279-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.