DPCstruct | MC1041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3FXL0 | 27-134 | LQPLPSGTVERNLDTVLDAVKTVDQTCDYKRCKQKTNMMGSNCTFCKQRFCFKHGLPEIHGCGEEVKRKEREEFLHPLPAKTVQAQE… |
| A0A7R8YYT8 | 34-141 | ERDLSNVLEAVKILDVHCAFAKCKRKTNLMGQNCEYCRERYCFRHGLPEIHGCGEAVRHDERKKFLHPEAAVTSRQREDLAKAKKRL… |
| A0A0V0QWP0 | 438-547 | None |
| F0ZPP4 | 635-747 | None |
| A0A7S2P6F4 | 5-144 | None |
| A0A673XKT3 | 771-893 | None |
| A0A1Y1Y7H6 | 6-133 | None |
| A0A6A4V9P1 | 28-156 | None |
| A0A5J4VSB2 | 7-107 | None |
| A0A2I1DRM5 | 47-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.