DPCstruct | MC10409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 4.00 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 95.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C2TVB0 | 935-1009 | VIETYDAAMAANLYDKALLFNGRTVRHYGATNHKEYFAEGTEAYLYRNDFYPFVAAELKIHDPALYTLMEKTWGS |
| A0A851GG07 | 115-187 | ITRAFQQAQKSGSYDAVMHVSGKKKRAYAMNNEKEYFAELTEAYFGKNDFYPFNRDELKRHDPEGYRMIESVW |
| A0A2E0R418 | 139-215 | None |
| A0A2E6L0Q4 | 182-260 | None |
| A0A317ZK33 | 682-750 | None |
| A0A7Y2T3S2 | 319-392 | None |
| A0A3D3L9M3 | 83-164 | None |
| A0A2H0QY03 | 261-337 | None |
| A0A5C6ERL7 | 406-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.