DPCstruct | MC10407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 163 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812T648 | 10-192 | KRKHSRMELGYCCRGCKADGCCTRDCQNQPFVEAPKSPGLAVVLEVSNEPSSREQQPPEEHNNMESNNVNIEMKVLGFMDTASPLGP… |
| A0A813GK08 | 86-241 | GATYPYGGTAFSQPQPVGQMPMMGTVVIGRPVMGHPVLPSLVIGGTSQSVTANVIHVGSPPASSGGWMSTAAPSGQSWQMFCNSSPV… |
| A0A812VHP4 | 878-1035 | None |
| A0A7S4W8P1 | 450-604 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.