DPCstruct | MC10406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 277 ± 26 aa |
| Standard deviation of domain lengths | 26.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ID90 | 294-566 | ENMDLAETDGASSNMRLLAHLVQQAKSNVAGRGGHPLLFTHCRCMNHAVQLNNASLLAIISPTLLNRIYGMTVFVRNLGYWMRIRQA… |
| A0A812J0U2 | 162-446 | TFRCGIWVLDSLKANMKLFRQERADLEKQREVQSAQDSQDMPVALLTTCNIHKLALIRKPMVLQPKDVWSTFVRLAHLFESLSFRQK… |
| A0A1Q9C0T8 | 471-736 | None |
| A0A812VAP3 | 277-579 | None |
| A0A812LFZ5 | 364-611 | None |
| A0A813BUJ8 | 793-1010 | None |
| A0A812M0W0 | 377-663 | None |
| A0A812SL41 | 8-268 | None |
| A0A812QTB9 | 133-442 | None |
| A0A812SZB1 | 333-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.