DPCstruct | MC10405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 377 |
|---|---|
| Mean domain length (aa) | 246 ± 59 aa |
| Standard deviation of domain lengths | 58.62 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.03 |
| Pfam Score | 99.39 |
| Assigned Pfam label(s) | CL0142- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9V1C3 | 109-301 | ASMLTVQAILSSKAKIALLALAATIPMIVGKIDLNVGFGIVLWHILAITLQVEYGFSWQMAVLTVLVVSALYGLLNGILVALADIDS… |
| A0A812XND9 | 799-1092 | FATLNGLVTGLLLFMLASGLTLIFSMMGVLNFAHASFYMLGAYFAYSISLYLGFWAGLIFAPLIVGVLGALVEKYALRRVHQHGHVA… |
| A0A538A3Z8 | 2-201 | None |
| A0A7X9KD54 | 10-172 | None |
| A0A5C4MDG9 | 354-635 | None |
| A0A534KC17 | 37-285 | None |
| A0A3B9J8J6 | 37-351 | None |
| S9S327 | 31-313 | None |
| A0A6I3C4E3 | 5-179 | None |
| F0NFL2 | 5-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.