DPCstruct | MC10404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 174 ± 33 aa |
| Standard deviation of domain lengths | 33.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 68.21 |
| Assigned Pfam label(s) | CL0013- PF07943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0YWG2 | 99-276 | SFTYNGITQYNRNGLLWDKSLNVDGMKTGHTNNAGYSLVSTATEGKMRLISVVMGTKSPNARKAESKKLLNYGFRFFDTVSPNKANA… |
| A0A812XKU7 | 165-333 | EFTYNNIRQSNRNSLLFRDRNVDGLKTGWTDAAGFCLVASAERDGMRLISVVMGTASEEARAIETQKLLTYGFRYFETHKLYDADQV… |
| A0A2N0QMX1 | 14-196 | None |
| T0DZ93 | 2-108 | None |
| A0A2A5H6W5 | 190-369 | None |
| A0A4Z0HDU5 | 837-1029 | None |
| A0A1Q9TCU2 | 165-335 | None |
| A0A1Q6KIH4 | 203-410 | None |
| A0A3S4FWV5 | 11-149 | None |
| I7JFQ6 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.