DPCstruct | MC10403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14995 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4UCR4 | 1-134 | MKAFDALIPTRFMASICFLISVMMVFSTMADNIIVSLPSTYSQTSYDSYKSSLNLVLSLHIICICFNLAGFLFGFSMFIPSHTILVI… |
| A0A812XKK8 | 140-266 | DGLLRMLGTAFAGSWFLATTGQLIAVLTVLLDKEPYIQAALPVLYTREEYDAADGDFTRVLVLCTTCLTIELASFLVSGVTLFANRV… |
| W2T8T6 | 4-131 | None |
| A0A3M7RRM4 | 3-131 | None |
| A0A7S4NI15 | 6-142 | None |
| A0A388LF71 | 11-150 | None |
| A0A1S8W9G7 | 4-120 | None |
| A0A812YUC3 | 3-149 | None |
| A0A812D3W8 | 59-183 | None |
| A0A1I8D2T6 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.