DPCstruct | MC10402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 410 ± 51 aa |
| Standard deviation of domain lengths | 51.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3Y0H2 | 16-377 | QFPLILWHPSARHYYFCMMTEAEQDKWQAILQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNLVME… |
| A0A812WM96 | 61-458 | KFGIKLVPYDDRRRQWSFNCETEEDKAEWLKIFRNACNKANPPTNDDVLVAQAFKGAIKAVRWSYGLYGWYRVTGTEAEALGGIVSD… |
| A0A267ED61 | 4-338 | None |
| A0A4Z2BJK3 | 30-428 | None |
| A0A493U3R0 | 241-664 | None |
| A0A3L7IFV1 | 3-359 | None |
| A0A6P8Q290 | 130-593 | None |
| A0A3P8WSA8 | 136-582 | None |
| A0A7J5ZJX9 | 128-572 | None |
| A0A7N8X7A2 | 14-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.