DPCstruct | MC104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139DNS4 | 19-91 | RRESFIKQLNTTPPVPCDLKVGQTVSYTNEYGVTFPGHTIVGFSATDSFYGRFIHLDTDCYWMPKHPASVTPE |
| A0A2S5GHZ4 | 12-82 | LRQEAPVPCDVQVGDRVTFTNEYGVSFAGMRVIGFADDESFYGRFIHLTGPEHPGAYWFPHKRDELVKEAA |
| B7XGN2 | 1-59 | None |
| A0A5B5VJV6 | 26-106 | None |
| A0A6G9QP52 | 20-86 | None |
| A0A1M3LDE3 | 31-96 | None |
| A0A373ZRY8 | 9-72 | None |
| A0A1I7KL09 | 22-88 | None |
| A0A5N7WEH1 | 65-146 | None |
| A0A5C7RKN2 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.