DPCstruct | MC10399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 208 ± 17 aa |
| Standard deviation of domain lengths | 17.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E1X1G6 | 471-670 | KRDTSIKEIRSVITNKDYQTKTAVQFMGEIDSRKSEITKLYNLTDHEYNELSKLAFGILGNESQFGESSRYHVKEALPWLVAIAKGN… |
| A0A7H9MNE5 | 1-197 | MLVPNSDEVQTIQVRRFIQALAVNKIELQKMYKVSGDEYTLLAQMSVGILGRETRFGESARYKVKETMPWAVSLAKVMRSVTTGKGV… |
| A0A162FXN5 | 177-366 | None |
| A0A2E3XU41 | 270-472 | None |
| T0RMU8 | 350-541 | None |
| A0A514XDY0 | 46-259 | None |
| A0A1F6UQU5 | 360-547 | None |
| A0A2E3VWC2 | 518-757 | None |
| A0A2E5CA00 | 845-1081 | None |
| A0A514WSE4 | 5-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.