DPCstruct | MC10398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 278 ± 35 aa |
| Standard deviation of domain lengths | 34.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123- PF08782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1S983 | 6-239 | AIDTPSHKGKFGWERLGTETTDVPGTAAVPVIVRTNEIRYCPTRIVEQEVIKKYANLPQSVFTCITLKSFYLTAVEARLLNEINLHH… |
| A0A6P4HB82 | 29-289 | NTDNSSSDKKSSFSSFSDLSESIYGHFGWVQLGKVLIPYIFRQSEKYCSVRMIEQKILGQYLDFLHSDFYSSCSCVPSYYITDAEAR… |
| J9JW02 | 49-363 | None |
| R7U3E1 | 1-280 | None |
| J9JZ32 | 111-400 | None |
| J9K5W3 | 292-543 | None |
| A0A7R8Z7L0 | 43-357 | None |
| A0A7J6Z6J3 | 44-344 | None |
| A0A498LAY4 | 1-327 | None |
| R7ULS9 | 39-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.