DPCstruct | MC10396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 11.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D6CFY5 | 4-81 | DNNLEHALEDLQKNGYTCSFIKNNDYIYCTEKDMNFRSYELNITEKFRFEDKQEPSRNSILYAIESPEFGVKGFLLHG |
| A0A1A9I5E2 | 5-104 | ETSSQKMSTISECIKHAAKEGYTRSFFITGSGLSYNGAPKAYAPGEVIIKNFYRFEGGSDPADNSVLYLLQTPDGARGILLDAYGIY… |
| A0A4R6IR58 | 28-115 | None |
| A0A7V5BF07 | 10-103 | None |
| A0A7V9B452 | 22-114 | None |
| A0A7Y5BBD4 | 4-99 | None |
| A0A6N2DEB3 | 87-182 | None |
| A0A5D8YR56 | 3-92 | None |
| A0A1M5A8F0 | 47-142 | None |
| A0A7Y4XNR2 | 9-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.