DPCstruct | MC10392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 201 ± 40 aa |
| Standard deviation of domain lengths | 40.28 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.50 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | PF11712- PF14942 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q54FJ8 | 31-211 | LKFTITPLIKSTISNDNKLKEKYSKYTNNQQPFIPFSILKDIAKTSTTKVYFQDLIKDSIIYYPPKAEVTPDPEFIARKQHLEKLNK… |
| A0A0L0HUE3 | 2-215 | VRLVVTEKIRSAIELALLEEALDTSLAEKLKPYSQRSRSENRPDAEDPDTISHELLNEVSKALLHQRADDDRQDFYFHELVKGSEVY… |
| D6W8A4 | 156-349 | None |
| A0A4S2N3S6 | 2-209 | None |
| A0A7S2RMW0 | 9-173 | None |
| A0A0K0EKY0 | 2-164 | None |
| G3J4B9 | 1-230 | None |
| A0A1X2IKE9 | 10-199 | None |
| A0A667HMB8 | 1-137 | None |
| A0A7R8XDD2 | 3-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.