DPCstruct | MC10391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 347 ± 68 aa |
| Standard deviation of domain lengths | 68.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5NWU6 | 52-344 | DLLLATKVPQIFAESAVSGDGTDWTLEELRLLGDIGIAMPVTVYDNGLHSAPQIHEPPFPATLLFVPGALLRNERNQPPADWLEATK… |
| A0A0L0HSH8 | 26-313 | WIKVGTESEGLIHMKDYLTYEEMGVAALLGLSAPVFFVNAGRRYNRGKLGEDGTFESSGIYTALVGARYEVPGKMEWRHTLAYPDQE… |
| A0A226ESD7 | 316-672 | None |
| A0A5B7CVS7 | 14-336 | None |
| A0A6C1PD01 | 324-626 | None |
| A0A3M1SXS1 | 45-428 | None |
| A0A226EQ51 | 171-479 | None |
| A0A2H9TCF1 | 199-505 | None |
| A0A813AKG3 | 117-450 | None |
| K2BCJ0 | 45-425 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.