DPCstruct | MC10389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 159 ± 37 aa |
| Standard deviation of domain lengths | 37.29 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07742 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846J5Z6 | 2-132 | SKSIKEIAKIASEWWADKVANTKFDNGDDSSNGEIATCLAVMNTKSVASISKEKFINKLSHIIEEQLLKEFNIELSVDYRACRELNE… |
| A0A0L0HE45 | 1-163 | MYTEVRTAATFLAKFLQSKSSSASATAERLLTFEQALVDRLMERFKGHWDPQRPCKGNAFRAVCVLNGVVDRVVVEALMAAGIKAEE… |
| A0A0N5D0L7 | 1-171 | None |
| A0A814DSK0 | 2-198 | None |
| A0A146HP54 | 9-187 | None |
| E3KVJ5 | 4-208 | None |
| A0A813Q9B2 | 3-182 | None |
| A0A6A4H1K2 | 1-214 | None |
| A0A1Y2HJV4 | 82-235 | None |
| A0A2N0AYX7 | 199-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.