DPCstruct | MC10388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 175 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8JHB6 | 198-368 | ALEIPADLPSSDVIDRWVGEPVKCAILNTNVFLTNKKGFPVLSKAHQSLVMKLFKLDVQMMIAGTNHHPDKGIKAYQQYLDHLYQSQ… |
| A0A5B0NFG0 | 1-151 | MGAAIDVPALINRWTAEPIGFLLIPATSFISNAKHYPVLSKSCQTFVKAMLKYKPSVILSQTSEGKHSSGGSLAYAQYIRFLEKRAA… |
| A0A1E3QRS0 | 196-351 | None |
| A0A024GBX4 | 343-487 | None |
| V5H6U8 | 69-237 | None |
| A0A376BBA1 | 217-423 | None |
| A0A177B0A7 | 181-345 | None |
| A0A453N994 | 77-269 | None |
| A0A0V0WFJ2 | 45-219 | None |
| A0A0B1PD68 | 116-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.