DPCstruct | MC10385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 9.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9I981 | 48-141 | EMLAQDALRHHELAFPLRTLPPGSADANSLPNPGDYHWKKNGEVHLNDPIAIAKLQEAARINSREAYKEYSRCIQELNKACTLRGML… |
| A0A5B0LM95 | 1-73 | MLFVQPPGLPESGEYHWRDGGEAHINNLVSIAKLQDAVRSKNQSAYDVYSQNAQKQVRAVTLCGLLDFDYESA |
| A0A0R3S366 | 45-136 | None |
| A0A7J7LJ34 | 134-241 | None |
| A0A1D6MBZ9 | 525-612 | None |
| A0A2U1Q636 | 455-533 | None |
| A0A6G3UZJ7 | 1-107 | None |
| A0A6J1W9E8 | 98-197 | None |
| A0A7J7M0G1 | 203-308 | None |
| A0A0C9XRZ4 | 273-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.