DPCstruct | MC10384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 109 ± 25 aa |
| Standard deviation of domain lengths | 25.17 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8MJ52 | 182-295 | TCPNLGRLYGKYRGIGELLQEAEDNKQGVMLRYVHHVLNDDFKNDEVFRGLVEAMVLAKERQLANKSMKNFKYTPAFDDFMHVLHDI… |
| A0A5B0MUD1 | 3-100 | LEKATKEDDQTFWKLFAAHAASGKFDNLKPFKGLVMAVSVRHERESVGKSLTGVQFSPQFNDFMMTLAAISPRGAHFFQETFAGRSL… |
| A0A225X2G2 | 168-297 | None |
| A0A2I1F2I3 | 192-281 | None |
| F4SB29 | 474-616 | None |
| A0A4Y9ZQ51 | 485-612 | None |
| A0A4Y9ZUX2 | 674-807 | None |
| A0A397UNC7 | 235-326 | None |
| A0A2Z6R9G8 | 194-277 | None |
| A0A2Z6QYJ1 | 240-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.