DPCstruct | MC10383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 173 ± 42 aa |
| Standard deviation of domain lengths | 41.93 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0MTC7 | 1-168 | MRQTNKWLLYLHKDSRVETVDFDVLAVFIMQETDAKMHIRDLVATIIENFSGSSTPQTNRQNQLLEAAFVVYETIYCYNQGVLLQPD… |
| A0A5B0S548 | 307-472 | FERIEVLKMRGIEYGDKDIKTVMRQTNKWLLDLHKDSHVETVDFDILVVFIMQETDAKMHIRDLVATIIETFAGSNTPQTNRQNQLL… |
| A0A180G4V5 | 31-178 | None |
| F4SC82 | 1-213 | None |
| F4S0F5 | 168-359 | None |
| F4REQ7 | 181-384 | None |
| A0A5B0QSW9 | 28-189 | None |
| A0A5B0QRQ3 | 30-164 | None |
| A0A5B0QHG0 | 22-312 | None |
| E3KWP8 | 25-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.