DPCstruct | MC10380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 19.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P8WPD2 | 222-332 | RLHHPDRREVVLKLDQPWEGLTSAYFAMVPDGDRVLMYYRGQVTPGSEGQVCCVAESRDGIHFERVNAGLFDYKGSKDNNIVWKGVG… |
| A0A2D5X891 | 20-153 | VGRHIDVADRKQLFLDDGFLIERAEGIRYVLHQPVKCADNPLIVPDRPWEQQVQLYGSVLWDEERTLYRMWYTARTHRHGKDGAVVM… |
| A0A6N8WA04 | 25-152 | None |
| A0A286RLH9 | 14-132 | None |
| A0A257W9H2 | 21-163 | None |
| A0A6M8SUD1 | 1-117 | None |
| A0A7Y8M1F5 | 30-145 | None |
| A0A2E0XPU0 | 1-100 | None |
| A0A2E7RTV3 | 24-159 | None |
| A0A0S8ER48 | 231-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.