DPCstruct | MC1038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 138 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F3AKQ4 | 67-203 | TGIAHVPPIVSGNSALFVTPSGRKVRDIAYDLGADSWAGRDVGILAGHLFEGAQVEEWAYARDPDSIVWCVRSDGLLLGFTYLKEHD… |
| D6PJV0 | 1-153 | MFLQRARRKLRELAYNFDVDGYVAPDLTILAEHISEGGFKQLSYQQEPNQVIWGVRNDGQLVGLTYQREQQVVAWHRHIFGGSAVCE… |
| A0A356HVI7 | 202-338 | None |
| A0A7V8DGM6 | 445-577 | None |
| A0A497PUJ6 | 453-591 | None |
| A0A6M3IKC5 | 628-768 | None |
| A0A370CHG9 | 3-119 | None |
| D3LVF7 | 686-818 | None |
| A0A0F4VIK6 | 342-491 | None |
| A0A6M3XL15 | 2-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.