DPCstruct | MC10378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 80 ± 4 aa |
| Standard deviation of domain lengths | 4.14 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6RYN7 | 10-92 | LPERHEVLSKLTDLINGACSPAEASDWANRWVLADHDPIVDVRIDDRAVWDALMQMSGADLYGGDREFLHDHVDYQAWLDQLR |
| A0A841PS77 | 1-81 | MNEPNMSEIIKRLEKVLSGELKREDISDWASLYVMDDEPNVDDENVWEMLKIMSGIDILDSPTTYLYNQEDIKQWIEKAKD |
| A0A1F4QNT3 | 148-226 | None |
| A0A1F4QNW5 | 117-197 | None |
| A0A0M0WVQ9 | 1-85 | None |
| A0A377FTN7 | 115-196 | None |
| A0A6H2JWI7 | 25-102 | None |
| A0A167TWG4 | 33-115 | None |
| A0A291QJ58 | 51-130 | None |
| A0A8A8B865 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.