DPCstruct | MC10375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 239 ± 39 aa |
| Standard deviation of domain lengths | 39.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 13.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5J661 | 552-799 | MAGQLSTLYYQAYQMALELAQQAQTCYQYELSSSDTFLTGNPWNDQYKGLLAGDALSLSLAQMEKAYHDNNSRYQEIHKTFSLMQQN… |
| A0A5E7DF94 | 179-426 | YDWLNSKFASFYYSAYNTAQSLCQAAEACWQYEMGDFTQTFIRPGAWNSSYRGLGAGEALKMNLLQMHREYLKNNKRDLEIRKTVSL… |
| A0A6N0Z9Y8 | 81-324 | None |
| A0A1Z3HSZ5 | 28-219 | None |
| A0A226F2A4 | 830-1126 | None |
| A0A6P8I6F6 | 242-531 | None |
| A0A3Q9D825 | 221-437 | None |
| A0A3B9EZF9 | 165-464 | None |
| A0A849EWZ7 | 732-959 | None |
| C3ZK18 | 51-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.