DPCstruct | MC10370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 221 ± 29 aa |
| Standard deviation of domain lengths | 29.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.95 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1ZY69 | 1-171 | MVTAASARSTTQAAMADAVRARKAQEEKEKLKRKERAERIAQEQEEKKKREEKKAKNLAKIEAKQKPVEEQAPLLDIRNLPALLPES… |
| A0A6A6HMG7 | 15-248 | SEEPLATTNPQDLHANDQPGPESDSDDDAPEAIGHTLARDEAMATKREASRAIVDRKQADRQKRKTQAARLEEQAKISKRSSKRKRA… |
| G0R7C2 | 7-218 | None |
| A0A6A6USH3 | 47-273 | None |
| A0A093XJB9 | 190-411 | None |
| A0A1L9WXT6 | 1-197 | None |
| A0A0G2E070 | 111-357 | None |
| E9D836 | 1-203 | None |
| A0A6A6JPA8 | 233-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.