DPCstruct | MC1037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 633 |
|---|---|
| Mean domain length (aa) | 134 ± 35 aa |
| Standard deviation of domain lengths | 34.56 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 69.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.47 |
| Pfam Score | 97.19 |
| Assigned Pfam label(s) | PF05022- CL0214- PF06480- PF00542- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2LP70 | 17-150 | FARRTACRKCQQSKDGGSSANEGSSSSHFNSRPGDWNCPMCKEFNFSRNSSCRKCGSSKDGNTSSKPMRPGDWICPSCNDHNFARNT… |
| A0A843M0D3 | 16-138 | DYPIFCFCGQENDEFSQFCSNCGFPLDNFEKTDGNIQKLCFCSTLNDVTADFCVDCGIDLKNENKALICVCGTKNPISAKFCSSCDR… |
| A0A834SLU5 | 102-197 | None |
| K8EGE0 | 86-254 | None |
| A0A7S2U5D9 | 8-158 | None |
| A0A1S8VZQ7 | 68-248 | None |
| A0A0S8CXG5 | 3-108 | None |
| A0A2H0DVE7 | 9-119 | None |
| A0A5E4EW71 | 115-267 | None |
| A0A482VC88 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.