DPCstruct | MC10364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 159 ± 23 aa |
| Standard deviation of domain lengths | 22.96 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2FI13 | 515-685 | RAERPFAAENIIILTDGYCASACSIFVEHLKNEFRVMSIVVGGRPQSGPMQTIGGVRGSRLFSYDFLAYLVEAYTEQITANPKSADA… |
| A0A3M7JLG2 | 22-187 | IIILSDGLCSSACALFMELMHHEAGVRTVVIGGQPSYGPMQAPSGNRGAAIYKAENMHRDIELARDIDKSRHVDLPNRASAFLITTA… |
| A0A015L2L8 | 1-143 | None |
| A0A3N4L2N7 | 521-678 | None |
| A0A4U0V677 | 324-469 | None |
| A0A317AF59 | 132-277 | None |
| A0A5J4WB09 | 83-223 | None |
| A0A1W0A4H9 | 16-155 | None |
| R8BL77 | 3-166 | None |
| A0A7J6R993 | 92-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.